- Recombinant Human adenovirus A serotype 12 Early E3B 12.7 kDa protein
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1063634
- Early E3B 12.7 kDa protein
- 17-110
- E Coli or Yeast
- 12,765 Da
- Recombinant Protein
- >90%
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- 1 mg (E Coli Derived)
Sequence
SSCQLHKPWNFLDCYTKETNYIGWVYGIMSGLVFVSSVVSLQLYARLNFSWNKYTDDLPEYPNPQDDLPLNIVFPEPPRPPSVVSYFKFTGEDD